SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284989622|ref|YP_003408176.1| from Geodermatophilus obscurus DSM 43160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284989622|ref|YP_003408176.1|
Domain Number 1 Region: 1-74,106-126,154-235
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 1.8e-34
Family Patatin 0.038
Further Details:      
 
Weak hits

Sequence:  gi|284989622|ref|YP_003408176.1|
Domain Number - Region: 218-317
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.0225
Family Tyrosine-dependent oxidoreductases 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|284989622|ref|YP_003408176.1|
Sequence length 322
Comment Patatin [Geodermatophilus obscurus DSM 43160]
Sequence
MRVGVVLGGGGVVGQAYHSGVLAVLEHDFGFDARTVDVIVGTSAGSITGTLLRLGVSAED
LAAWTVKAPLSDEDEVLRHVAGTPVPELAPFNPLHVLRRPLRLPGRHMVQRALARPWQFR
PLAAGMALIAPGQHDIAEQLAALRELEGPGWPDPDLWICAVRQRDGRRIVFGRPGTPEVP
VHQAVAASCAVPGYFAPVRIGGHGYVDGGVHSPTNAAVLRGRGLDLVLVISPMSGPAGWL
PDVYAASRRHAARLLRQEVRALQRAGIRTVVFAPGAAEQRAMGNDMMSRHDLNGVIQTSF
LATGAYAARPEVADLIRAAVGR
Download sequence
Identical sequences D2S9U2
gi|284989622|ref|YP_003408176.1| WP_012947246.1.76031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]