SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284989854|ref|YP_003408408.1| from Geodermatophilus obscurus DSM 43160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284989854|ref|YP_003408408.1|
Domain Number 1 Region: 676-925
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 4.26e-60
Family Tyrosine-dependent oxidoreductases 0.0000975
Further Details:      
 
Domain Number 2 Region: 189-329
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 8.77e-34
Family Aromatic dioxygenase reductase-like 0.0014
Further Details:      
 
Domain Number 3 Region: 75-206
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 5.28e-25
Family Ferredoxin reductase FAD-binding domain-like 0.00022
Further Details:      
 
Domain Number 4 Region: 1-96
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 9.18e-23
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.00091
Further Details:      
 
Domain Number 5 Region: 521-656
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.00000000000000233
Family GntR ligand-binding domain-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|284989854|ref|YP_003408408.1|
Sequence length 928
Comment Oxidoreductase FAD-binding domain-containing protein [Geodermatophilus obscurus DSM 43160]
Sequence
MDHRVALAFEDGVTRFITCREDQTVADASYRARINIPLDCRDGACGTCKSLCESGEFDGG
AYLEDALSADEAATGYVLPCSMKPRSDLVLQIPTTSAVAKTSAATHRGRITVLDRLSPTT
VGLTVEIDDRDALAFLPGQYVNIAVPGTEESRSYSFSSAPQDEALTFLVKLTPGGVMSTY
LAERAEVGDEITFTGPHGSFFLRDSDAPLLLLAGGTGLAPVLSILRTLAGNRSDRGMHLV
YGVTTDDDLVEMDTLEQLAGAIDGLTWDYCVADPATTAPNQGYVTGLYGPEHLHDGDAAV
YLCGPPAMVEAVRGHVAALGVAPSGFYYEKFALAAVPTEAAGEVAGPEPGAVVPEPEEVA
PEPPPVPVVVPDTVAELLALDGREGRTSAGQALFPPVELFPLGADAARPRVESPEQMWRV
AGQRIGEPFPTGDVLPVDDADDLVPAVGARAVAGQEMLPEVALEQLTPPTPEAPAGQADA
DQADGDQADAEIEPALTAEGYTITGDGYEIGEEHPSVHESDAIFDARRALELGALELTIG
RLTHQQLVGYRVLAEATVPYVEGDRFVDAAAYTETNAAFHDYLFTLTGNEHLLRAYQALG
VKGHMEESLRSATWVHPRCAQDHLDIVEAFRNGHRERARILVTEHAERSKETTRRAMHDL
AAGRRPRFVTPGRFAGQVVLVTGAGQGIGQRTARRISAEGGTLVLADRAELVRDLAGELT
RPGAEAVPVVADLETWEGASAVVDAALARFGRIDVAVHTVGGTIWAKPFEHYPADQVQAE
ISRSLWPTLWCCRAVVPHMVERGRGTIVNVSSVATRGLNRIPYAAAKGGVNAITTALALE
MAPHGVRVVATAPGGTEAPPRRTPRGPAPATEQEEAWYRTIVDQTVESSLLKRYGTLDEQ
AAAITFLASEEASYITGTVLPVAGGDLG
Download sequence
Identical sequences D2SB89
WP_012947478.1.76031 gi|284989854|ref|YP_003408408.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]