SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284990007|ref|YP_003408561.1| from Geodermatophilus obscurus DSM 43160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284990007|ref|YP_003408561.1|
Domain Number 1 Region: 4-356
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 4.05e-57
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|284990007|ref|YP_003408561.1|
Sequence length 361
Comment hypothetical protein Gobs_1460 [Geodermatophilus obscurus DSM 43160]
Sequence
MTDLLAIGTRKGLWLARSDDDRRTWTLGEPHLLAQEVAAVSIDTRGPAPRVLAGIQYGHW
GPTVMRSDDLGASWQETETGAIRFPEDTGAALARVWQLRPDSADRPGVVWAGCEPHSLWR
STDGGCSFELVRGLWDHPHRPTWAPGAGGGAVHTVLPDPASDRVTVAMSTGGVYVSEDGA
SAWEPRNAGISAVFLPEPAPEYGQCVHKVAVDAAGPYRMYAQNHFGVFRTDDAGGSWTSI
AEGLPADFGFPVVASPSTPGTAWVVPLVADAQRVPPDGRLQVQRTRDAGETWTALTSGLP
DACWAAVVRDAACADEADPTGLYLGTRDGCVYASADEGDTFTLVADHLPDVLVVRAARIR
P
Download sequence
Identical sequences D2SC22
WP_012947630.1.76031 gi|284990007|ref|YP_003408561.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]