SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284991122|ref|YP_003409676.1| from Geodermatophilus obscurus DSM 43160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284991122|ref|YP_003409676.1|
Domain Number 1 Region: 10-259
Classification Level Classification E-value
Superfamily Cgl1923-like 5.62e-87
Family Cgl1923-like 0.0000949
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|284991122|ref|YP_003409676.1|
Sequence length 286
Comment hypothetical protein Gobs_2670 [Geodermatophilus obscurus DSM 43160]
Sequence
MIDPKSTPEDLPRLDDPVVVVAFEGWNDAGDAATGALEHLELIWDATPLAALDPEDYYDF
QVNRPTVSLIGGVSRRVEWPTTRISVARPPGSERDVVLIRGIEPNMRWRSFCEELIELCQ
ELDARTVVGLGALLADTPHTRPTPVFGSAYDAESAEKWGLDTSRYEGPTGILGVFQDACV
QSGLPAISFWASVPHYVSQPPSPRATVALLRRVEEVLELTVPLGALPQQAEEWVKTVDEM
ANEDAEVVEYVRSLEERATESDLSEANGDQIAREFERYLRRRGGTA
Download sequence
Identical sequences D2S6D1
gi|284991122|ref|YP_003409676.1| WP_012948738.1.76031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]