SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284991146|ref|YP_003409700.1| from Geodermatophilus obscurus DSM 43160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284991146|ref|YP_003409700.1|
Domain Number 1 Region: 19-76
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.72e-16
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.0097
Further Details:      
 
Domain Number 2 Region: 78-156
Classification Level Classification E-value
Superfamily Dimeric alpha+beta barrel 0.00000000000241
Family Lrp/AsnC-like transcriptional regulator C-terminal domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|284991146|ref|YP_003409700.1|
Sequence length 161
Comment AsnC family transcriptional regulator [Geodermatophilus obscurus DSM 43160]
Sequence
MSSSSSPADHGGGPLTSGDVDRALLAALARDGRASYTELAEKVGLSVSAVHQRVRRLEQR
GLITGYHAKLDAALLGLGLTAFVAITPTDAASPDEAPSLLAHLPEIEACHSVAGVESYLL
KVRTSSPDALEALLRTIRQTAKVTTRTTVVLSTFYEDRPPL
Download sequence
Identical sequences D2S6F5
gi|284991146|ref|YP_003409700.1| WP_012948762.1.76031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]