SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284992187|ref|YP_003410741.1| from Geodermatophilus obscurus DSM 43160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284992187|ref|YP_003410741.1|
Domain Number 1 Region: 91-225
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 2.04e-23
Family GntR ligand-binding domain-like 0.019
Further Details:      
 
Domain Number 2 Region: 17-89
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.04e-19
Family GntR-like transcriptional regulators 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|284992187|ref|YP_003410741.1|
Sequence length 261
Comment GntR family transcriptional regulator [Geodermatophilus obscurus DSM 43160]
Sequence
MHNAAGSGGSNVSGADHIHALPLREHVYGRLQELLIARTLAPGDHLVEERLAAELGVSRG
PVREALQRLHRDGWITLRPRQGAFVNQPTRQQVEEFFEAREVVERSAAELAAQRCTPEDA
AALLGICDEADADWARGVPAQQMAGHTARFHRTVMLCARNHLLLEFGEQLSQRSRWFFAP
LVSTIAPRAWAEHRQVAELIAAGRPDEAAAAMRAHVGQSRDSYLDTQLVDNTLPGPVAFR
RTRAPSGSRTGDAPRARRARA
Download sequence
Identical sequences D2SD21
gi|284992187|ref|YP_003410741.1| WP_012949795.1.76031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]