SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284992757|ref|YP_003411311.1| from Geodermatophilus obscurus DSM 43160

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|284992757|ref|YP_003411311.1|
Domain Number - Region: 208-289
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0575
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|284992757|ref|YP_003411311.1|
Sequence length 307
Comment hypothetical protein Gobs_4384 [Geodermatophilus obscurus DSM 43160]
Sequence
MSYRVFFACVLSLIVITLNAASARAQEPVTCDGISCPTTALRESAVQVSAAHVFGSGADP
VRLATNAAPPGPAFFVWHLRTPCTAEDAAAGVSCDSRTRACPQVESRVIQFVIVQRQRLA
QEGRVPVEDLAPSSETPVGAAYGPVIVDGGACVDITALNPPPSPGEVFRYFQTLPLPDLS
TQQQPPGNALAGLPVVFYTDGPTTQTFTVDIRGFTVDIVATASAFAWDTGDGTVLRTTDP
GSPYPDHTISHDYRSGTYTAALTTTWSGTYSVDGGATADVPGTTTTDGPPATFTVLQASP
VLTNPFD
Download sequence
Identical sequences D2SG72
gi|284992757|ref|YP_003411311.1| WP_012950365.1.76031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]