SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284992975|ref|YP_003411529.1| from Geodermatophilus obscurus DSM 43160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284992975|ref|YP_003411529.1|
Domain Number 1 Region: 18-249
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 8.71e-62
Family Tyrosine-dependent oxidoreductases 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|284992975|ref|YP_003411529.1|
Sequence length 261
Comment short-chain dehydrogenase/reductase SDR [Geodermatophilus obscurus DSM 43160]
Sequence
MPGPPTHPASGPRELPGTGRTAVVTGASSGIGAATATRLAAEGFDVVLGARRMDRLTGLA
ASIGARALPLDVTDPDSVAAFAGALDRVDVLVNNAGGAFDANPVAEADLDSWARTYEVNV
LGTVRLTKALLPALIASGAGDVLFVGSTAGLVSYEGGASYTAAKHGVHTLAETLRLELFD
QPVRVVEIAPGMVRTEEFALNRVQDQDRAEAVYRGVREPLVAEDVADCIAWALTRPHHVN
VDLLVVRPRAQAAQHKVHREG
Download sequence
Identical sequences D2S4K8
WP_012950582.1.76031 gi|284992975|ref|YP_003411529.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]