SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|294142886|ref|YP_003558864.1| from Shewanella violacea DSS12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294142886|ref|YP_003558864.1|
Domain Number 1 Region: 33-104
Classification Level Classification E-value
Superfamily Coronavirus S2 glycoprotein 0.0000068
Family Coronavirus S2 glycoprotein 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294142886|ref|YP_003558864.1|
Sequence length 215
Comment hypothetical protein SVI_4115 [Shewanella violacea DSS12]
Sequence
MKRHISIAILATSLLLTGCQSAYYGAMEKVGYHKRDIMVDRVEDARESQQEAQKQFSSAL
EEMQALLNHDGGDLETAYNKAKDEYESSQKAADDVSNRIEKVEDVADALFDEWQTEIGEI
SKASLRRSSESKLRETQGSYKQLVRTMKRAESKMAPVLTAMKDNMLYLKHNLNAQAIGAM
KGEFSSLQTDISGLIQEMNKSIAESNKFIAAMEGN
Download sequence
Identical sequences D4ZE25
gi|294142886|ref|YP_003558864.1| WP_013053377.1.44054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]