SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269955037|ref|YP_003324826.1| from Xylanimonas cellulosilytica DSM 15894

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269955037|ref|YP_003324826.1|
Domain Number 1 Region: 16-172
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.46e-20
Family Thioltransferase 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269955037|ref|YP_003324826.1|
Sequence length 212
Comment hypothetical protein Xcel_0229 [Xylanimonas cellulosilytica DSM 15894]
Sequence
MSTQTAANANLTASPVVDVFVDPLCPYAWITSRWILEVAAQRPVDLTFRLMSLYWLNEGR
DLDAGYRARLDAGRGIGRVAAAVQTEHGPEAFAAFYTAAGTRIHPGGRADYDAVAREALA
EAGLPEALADAASSDAYDEALRASHAAGMAPVGEDVGTPTIHVDGVGFFGPVLTRIPRGQ
DAVRLFDGAVALSAFPDFYELKRSRTGNPDFT
Download sequence
Identical sequences D1BUM7
446471.Xcel_0229 gi|269955037|ref|YP_003324826.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]