SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269957223|ref|YP_003327012.1| from Xylanimonas cellulosilytica DSM 15894

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269957223|ref|YP_003327012.1|
Domain Number 1 Region: 1-71
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.73e-20
Family Thioltransferase 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269957223|ref|YP_003327012.1|
Sequence length 79
Comment glutaredoxin-like protein NrdH [Xylanimonas cellulosilytica DSM 15894]
Sequence
MSITVYSKPACVQCDATYRALDKKGIEYTVVDITQDAEALEMVRGLGYLQAPVVVAGETH
WSGFRPDQIGALARQAATA
Download sequence
Identical sequences D1BWA9
446471.Xcel_2439 gi|269957223|ref|YP_003327012.1| WP_012879196.1.53538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]