SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|269957807|ref|YP_003327596.1| from Xylanimonas cellulosilytica DSM 15894

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269957807|ref|YP_003327596.1|
Domain Number 1 Region: 68-151
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000031
Family Thioltransferase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|269957807|ref|YP_003327596.1|
Sequence length 155
Comment hypothetical protein Xcel_3032 [Xylanimonas cellulosilytica DSM 15894]
Sequence
MPQLVALVALLAVTALVGGLWHARQGRIRVTAPGRGRGANESDATANLQPDTPQPGTPWA
ALGLTLGERATFLQLSAEVCSPCRATARVLTRVAATEDGVVHHELDVDQHLDLVKRLKVL
TTPTVLVLDPDGVEIARASGAMSPAQAQQALALSH
Download sequence
Identical sequences D1BZR0
446471.Xcel_3032 gi|269957807|ref|YP_003327596.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]