SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|283782960|ref|YP_003373714.1| from Gardnerella vaginalis 409-05

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283782960|ref|YP_003373714.1|
Domain Number 1 Region: 6-127
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, catalytic domain 1.31e-24
Family Thiamin pyrophosphokinase, catalytic domain 0.0058
Further Details:      
 
Domain Number 2 Region: 156-214
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, substrate-binding domain 0.0000249
Family Thiamin pyrophosphokinase, substrate-binding domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|283782960|ref|YP_003373714.1|
Sequence length 272
Comment thiamine diphosphokinase [Gardnerella vaginalis 409-05]
Sequence
MQRYYVAMEPLQRCVVLAAGDYYDHTREHVPDRALTIAADGGWDHACKLGLHVDALIGDF
DSVRLKLPTDAVITRLPAEKDDPDLLSALKVGWAKGSREFHIFGGLGGRVDHTISNIQLM
VRLARRGGIGFLYGDGQIVTAIHDGSLDFPASSGNDLRIVSVFSHTPVSNDVNEVGLKYQ
LKHATMHGDAVQGLSNELLNDTPAHIDVHEGTLIVTFPINAPLPQVSWFKRPIGDLGEVD
ASISEALAVPLESETTPTYSTTAAAEAMTYNE
Download sequence
Identical sequences D2RA79 D6T0S4
gi|283782960|ref|YP_003373714.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]