SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|283783421|ref|YP_003374175.1| from Gardnerella vaginalis 409-05

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283783421|ref|YP_003374175.1|
Domain Number 1 Region: 5-86
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000544
Family BAR domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|283783421|ref|YP_003374175.1|
Sequence length 103
Comment hypothetical protein HMPREF0424_0965 [Gardnerella vaginalis 409-05]
Sequence
MSGDELDKALAQLKKEDEKYTQLQKKYDRARAECEPLTYASTNVDKAKSKYEKALARWHE
LDKQFDDEHAWLIDAIDDARNKWYEAKQRVNGIIRKLTGANND
Download sequence
Identical sequences D2RBJ0
gi|283783421|ref|YP_003374175.1| WP_012914304.1.8703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]