SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|261819521|ref|YP_003257627.1| from Pectobacterium wasabiae WPP163

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|261819521|ref|YP_003257627.1|
Domain Number - Region: 90-140
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0288
Family SMI1/KNR4-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|261819521|ref|YP_003257627.1|
Sequence length 194
Comment hypothetical protein Pecwa_0164 [Pectobacterium wasabiae WPP163]
Sequence
MRNKKMNIDKSICKLVSFFKLNESNMGRMDYQVEGIPNLRCEIPLNGEILHFYTHTLLED
KPTFHGGAYLQLIEIDELSNILLGWRSSEENDAWNDDFIIFAERNGDVLYCDLSDITSPV
YGSIQKRNFQISNSLSEFIEIYTKVLKIEIEDFYCDVTDDDFNFKPEYLLAVENELKKVL
SSEFVANYMLFFYE
Download sequence
Identical sequences D0KDI4
561231.Pecwa_0164 gi|261819521|ref|YP_003257627.1| WP_012821997.1.14155 WP_012821997.1.36680 WP_012821997.1.70306 WP_012821997.1.77019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]