SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|261819614|ref|YP_003257720.1| from Pectobacterium wasabiae WPP163

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|261819614|ref|YP_003257720.1|
Domain Number 1 Region: 28-165
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000641
Family SMI1/KNR4-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|261819614|ref|YP_003257720.1|
Sequence length 174
Comment hypothetical protein Pecwa_0259 [Pectobacterium wasabiae WPP163]
Sequence
MGIVEKDFVGWRMNSSNFDSNLNKVKSAIILIENKLMVKLPIEFNDYLTLTNDEAIAPIR
KKEYCLAKYAQGVRSVRTSVLFPSEQVIEYTKLSQESIYDERYLLPTGLIVIGSNYDGDS
DSCIIYDVRPNSPTYLHVFNWRYYVDNVVVSEGLGLLAHSLKAFLSTPTAIDAL
Download sequence
Identical sequences D0KEI9
WP_012822072.1.14155 WP_012822072.1.36680 WP_012822072.1.77019 gi|261819614|ref|YP_003257720.1| 561231.Pecwa_0259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]