SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|261819778|ref|YP_003257884.1| from Pectobacterium wasabiae WPP163

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|261819778|ref|YP_003257884.1|
Domain Number 1 Region: 44-118
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000114
Family SMI1/KNR4-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|261819778|ref|YP_003257884.1|
Sequence length 131
Comment hypothetical protein Pecwa_0437 [Pectobacterium wasabiae WPP163]
Sequence
MSAYLYTEDELPEKFKYPSSYIEIMSMDVIPDIEPWSFICEFKESSAFWMREVKGKYPTR
RLVPFAKVNYSDDIACFDGADTSGEPKVYYVHAFASAGWEDRGYTDNFAEWLKMARFESA
RYKAEQAEDDV
Download sequence
Identical sequences A0A0H3I407 D0KFH6
gi|470152945|ref|YP_006281447.1| gi|261819778|ref|YP_003257884.1| WP_012822218.1.14155 WP_012822218.1.36680 WP_012822218.1.70306 WP_012822218.1.77019 WP_012822218.1.78307 561231.Pecwa_0437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]