SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|261819949|ref|YP_003258055.1| from Pectobacterium wasabiae WPP163

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|261819949|ref|YP_003258055.1|
Domain Number - Region: 61-98
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0628
Family SMI1/KNR4-like 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|261819949|ref|YP_003258055.1|
Sequence length 148
Comment type IV pilus protein [Pectobacterium wasabiae WPP163]
Sequence
MQGMLVLMALLVLIGGYQGARSTGDLSGDTAIETSTARQMLQTANTLGRLKAQGGNVLSL
CPGNRPSNLLSIPGLEDNPDIYCTEYNGRVFVWAKEKPGMARVLRELSRDSRLLARINEG
RVNTLVDPAPWPVPLPAGITEGSLVYIN
Download sequence
Identical sequences A0A094RS14 D0KGD1
gi|261819949|ref|YP_003258055.1| WP_012822383.1.14155 WP_012822383.1.23163 561231.Pecwa_0624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]