SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|261820407|ref|YP_003258513.1| from Pectobacterium wasabiae WPP163

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|261820407|ref|YP_003258513.1|
Domain Number 1 Region: 31-161
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000549
Family SMI1/KNR4-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|261820407|ref|YP_003258513.1|
Sequence length 167
Comment hypothetical protein Pecwa_1092 [Pectobacterium wasabiae WPP163]
Sequence
MNINDACLILNEWVFLSNGVMIDIGADEKYSFTRNAYLSESELSFFENESKIKLPGEYKE
FLIAVGSVDIFVGEVSSGIEILSPFDVKKFSKSVFENYGDDLFPNLFLTTSIPKLGYFGG
FLLDGDLGNNYGVFYPETPPELWIEECDFISFNDWIVRLIEFKSKKI
Download sequence
Identical sequences D0KJ65
561231.Pecwa_1092 gi|261820407|ref|YP_003258513.1| WP_012822802.1.14155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]