SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|261823506|ref|YP_003261612.1| from Pectobacterium wasabiae WPP163

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|261823506|ref|YP_003261612.1|
Domain Number 1 Region: 9-157
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000000103
Family SMI1/KNR4-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|261823506|ref|YP_003261612.1|
Sequence length 169
Comment cell wall assembly/cell proliferation coordinating protein [Pectobacterium wasabiae WPP163]
Sequence
MAIKLSIGIDYLDVKDVESKYGITFPSDYIDFLTKYNGIYIGAGSYCTIPFSKVDDGEID
FQEMYGINTINPSFDLLRANDIRNEVVVLDNPFIIGSDPGGNPFFINCEKSDSAVYYWDR
THIHFDNNFDYQETNEEGNIYKLSDSFYKFYDFIMVNVGGDKKTIKEHL
Download sequence
Identical sequences D0KCY9
WP_015731455.1.14155 WP_015731455.1.70306 561231.Pecwa_4305 gi|261823506|ref|YP_003261612.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]