SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|261823542|ref|YP_003261648.1| from Pectobacterium wasabiae WPP163

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|261823542|ref|YP_003261648.1|
Domain Number 1 Region: 22-150
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000353
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|261823542|ref|YP_003261648.1|
Sequence length 178
Comment hypothetical protein Pecwa_4349 [Pectobacterium wasabiae WPP163]
Sequence
MLLELTEIESKLHEKFSIFEGDMDDLTMKKGGFSIDEVGTLEKRLNITLHDKFKKFVLNY
NLNDFSLGSFMFGNGGSYLDKLFELNSKNDLIQWWGEGERPKNLLLVTYNDPYSVLLEVD
SGRIYAITDESDLNNIKPISFDFCFFFRGVGTSFLNKIDSTDVEKLVGSEDKFFWSCL
Download sequence
Identical sequences D0KD25
561231.Pecwa_4349 gi|261823542|ref|YP_003261648.1| WP_015731484.1.14155 WP_015731484.1.70306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]