SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|261823694|ref|YP_003261800.1| from Pectobacterium wasabiae WPP163

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|261823694|ref|YP_003261800.1|
Domain Number 1 Region: 3-192
Classification Level Classification E-value
Superfamily HAD-like 3.76e-42
Family YihX-like 0.000000586
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|261823694|ref|YP_003261800.1|
Sequence length 203
Comment phosphatase [Pectobacterium wasabiae WPP163]
Sequence
MLYIFDLGNVVIDIDFKRVLGVWSNLSSAPLATLQERFVMGEAFEQHERGEISDEEFATR
LCQEMGIALSFEQFSAGWQAIFVALRPEVIDIMQRLHQEGHRVVILSNTNRLHCSHWPAL
FPEVGTAADRLYLSQDIGLRKPELAIYQYVLTQEGVTPAQAVFFDDNAANVDAAQSLGIH
SILVTDRHVVPDFFAMQATTAKA
Download sequence
Identical sequences A0A0H3ICD9 D0KE82
gi|470157098|ref|YP_006285600.1| gi|261823694|ref|YP_003261800.1| WP_014702092.1.14155 WP_014702092.1.36680 WP_014702092.1.70306 WP_014702092.1.77019 WP_014702092.1.78307 561231.Pecwa_4501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]