SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|261819999|ref|YP_003258105.1| from Pectobacterium wasabiae WPP163

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|261819999|ref|YP_003258105.1|
Domain Number 1 Region: 298-456,566-618,752-851
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.65e-16
Family ABC transporter ATPase domain-like 0.035
Further Details:      
 
Domain Number 2 Region: 10-99,164-262
Classification Level Classification E-value
Superfamily PHP domain-like 0.0000000373
Family PHP domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|261819999|ref|YP_003258105.1|
Sequence length 897
Comment DNA repair ATPase [Pectobacterium wasabiae WPP163]
Sequence
MKDPPVIGSQWNKWDLHIHSPLTWLANSYTPDDIEDYVRTLGAHQLSLIAVTNYFYFRQN
ELEIVREEIARQGLAITVLANVEFRLDQQNRDDQFINVHILFSEKLSTERINEILSHLPI
RLTDGEGKNIYCYEKSVGDSGHGVDTITVALSELTSHLNSALRPFQDFLIAVCPNGYGGY
RPGATGRSAAAATEIDRQGQIIFGGVADREFYLRTDRYLGATIKPVFLCSDAHSMAQIGG
RYTWVKALPTFEGLRQALLEPESRLRIGDDWLAARTPKAHFSKIEVEGSIFDGQEIRFRQ
LTIPLSQDMVAIIGGRGTGKSLLLDALRSRFAGAAARGSEQRAVNVQNLCVELDKANGEK
VRFDTYSEGYEYLHVSQGEIKKLCQEPSLISDEIKKTLRLSSHHEAGSTGELLNENLSAW
RAWREFLTFKNERNEPINTRAFQEALARTAREKIDVLTSTRNREMIAQFRANSGQQATLT
QARKHATGLQTTIDTTVRDLITKIDAINAAVDDGMVIPYPDLSLLAAVVETKLASIDEQT
ARLAEDNRRIIASFQEQGLGQDIPGLLEKVQAYQLQADRAEEHLSTIDARETQYQQELLQ
RSELATAFIDTLLARQAVIDTAYASLATRPHLTDDQQALIRDILTDIRIYGRPHFDVAAF
YNGMLDHMNRGRFRASAEQTSVERLRDVFRVQTIADLHALLSNAPVIALPECPDRKLSIE
EFLWRSEYFNSQGPYALLNFLFSPEHIQQYLSVRAEFEYKGKTVEKLSAGQRGTFYVCLK
LATDAFGSPFVFDQPEDDLDNDFIMHNLVPLFRKIKQYRQVIIVTHNANLVVNCDAEQVI
IATNDEEVISYRAGALEYGDHDAPNSMRRAICDVLEGGRHAFEAREQKYGMLWLNPL
Download sequence
Identical sequences D0KGW4
gi|261819999|ref|YP_003258105.1| 561231.Pecwa_0676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]