SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000000986 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000000986
Domain Number 1 Region: 5-90
Classification Level Classification E-value
Superfamily SH2 domain 2.02e-25
Family SH2 domain 0.00000711
Further Details:      
 
Domain Number 2 Region: 106-153
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000000157
Family SOCS box-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000000986   Gene: ENSAPLG00000001565   Transcript: ENSAPLT00000001557
Sequence length 154
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742595.1:1079057:1079521:1 gene:ENSAPLG00000001565 transcript:ENSAPLT00000001557 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SALVTGWYWGSMSVAEAKERLQDAPEGTFLVRDSSHSEYLLTISVKTSAGPTNLRIEYQD
GKFRLDSITCVRSRLKQFNSVVHLIEYYVLMCKDRTETPSNGTVHLYLNKPLYTSAPSLQ
HRCRITINKCTNQIWELPLPTRLKEYLKEYRYQV
Download sequence
Identical sequences U3I166
ENSAPLP00000000986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]