SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000002191 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000002191
Domain Number 1 Region: 112-295
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.01e-46
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.047
Further Details:      
 
Domain Number 2 Region: 4-84
Classification Level Classification E-value
Superfamily WWE domain 0.00000000000000419
Family WWE domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000002191   Gene: ENSAPLG00000002751   Transcript: ENSAPLT00000002777
Sequence length 302
Comment pep:novel scaffold:BGI_duck_1.0:KB743260.1:1582472:1589493:1 gene:ENSAPLG00000002751 transcript:ENSAPLT00000002777 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENIWYWLDDFEWIEYGTEHPYHSSASVNSADLEQAFLADPKGTLLFSAGSQIYEIDFKD
MVQRNLVSETRRKVVRLPKALSPPFGHNMSQDTNLSFSSCPPEWDQSAVPDIGYKLVELS
SSSSEYVKIKRLFEKTMKHYNICRLQRVQNPSLWQVFQWQKEQMKKLNKSKCVDERLLFH
GTNPSLLPAICEQNFDWRICGVNGTAYGKGSYFARDARYAHDYSSSKSGRYSMFVAQVLV
GEFVQGQSEYLRPPPRPSSPNRLYDSCVDDPEDPSIFVIFEKYQIYPAYILEYRIESSCV
IL
Download sequence
Identical sequences U3I4M0
XP_012956850.1.99704 ENSAPLP00000002191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]