SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000002320 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000002320
Domain Number 1 Region: 33-170
Classification Level Classification E-value
Superfamily Macro domain-like 8.58e-40
Family Macro domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000002320   Gene: ENSAPLG00000002869   Transcript: ENSAPLT00000002908
Sequence length 171
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744057.1:172807:175416:1 gene:ENSAPLG00000002869 transcript:ENSAPLT00000002908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLFLSVIFLATGVFTIAHVTMATQVFKEQGERIKCVKGDLFSCPQTDALAHCISEDCRMG
AGIAVLFKKKFGGVQELLDQQKKTGEVAVLQRDDRYIYYLITKKKVSHKPTYEDMRKSLE
AMKTHCLNNGVTDISMPKIGCGLDRLDWDKVSAILGEVFEDTDIKITVYTL
Download sequence
Identical sequences U3I4Z9
ENSAPLP00000002320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]