SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000002540 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSAPLP00000002540
Domain Number - Region: 401-473
Classification Level Classification E-value
Superfamily Macro domain-like 0.0073
Family Macro domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000002540   Gene: ENSAPLG00000003055   Transcript: ENSAPLT00000003130
Sequence length 552
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742617.1:1504591:1527220:-1 gene:ENSAPLG00000003055 transcript:ENSAPLT00000003130 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPNKGNVCIRERDYVYEFNAGNQHLVLTVPLKFPVQENVSHLHGRLMLLHNLPCFIEND
LKQSLSKFIEEETIKDYDREAEMALEAVKSGKVDINQLADAWSKAYKETTLEYAKPEETS
WDEDFADVYHDLIHSPASETLLNLEHNYFVSISELISERDVELKKLRERQGAEMDKVMQE
LGKSLTDQDVNSLAAQHFESQQDLENKWTNELKQSSAIQKQEYQEWVIKLHQDLKNPNNS
SISDEIKVQPSQLRESVEGNGRIYEEQRLLEESFTIHLGAQLKTMHNLRLLRADMLDFCK
HKRNHRSGVKLHRLQTAMSLYSTSLCGLVLLVDNRISSYSGIKRDFATVCQECTDFHFPG
IQEQLEIVQKVVLKARAQRSSKSKRHHDTGNKESGTEDKSKNIERNQSNILPGEFYITRH
SNLSEIHVAFHLCVDDNVRSGNITARDPAIMGLRNILKVCCTHDITTISIPLLLVHDMSE
EMTIPWCLKRAELVFKCVKGFMMEMASWDGGISRTVQFLVPQTISEEMFYQLSNMLPQIF
RVSSTLTLTSKH
Download sequence
Identical sequences U3I5L9
ENSAPLP00000002540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]