SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000003078 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000003078
Domain Number 1 Region: 14-151
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.14e-46
Family G proteins 0.000000575
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000003078   Gene: ENSAPLG00000003603   Transcript: ENSAPLT00000003673
Sequence length 180
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744306.1:921257:928682:-1 gene:ENSAPLG00000003603 transcript:ENSAPLT00000003673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSFIAKFRVFFSLAGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLV
YDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNEKRQVSKEKGEKLAIDYGIKF
LETSAKSSINVEEAFFTLARDIMTKLNRKMNDNSSSGAGGPVKITENRSKKSSFFRCTLL
Download sequence
Identical sequences U3I757
ENSAPLP00000003078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]