SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000003896 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000003896
Domain Number 1 Region: 62-456
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.28e-91
Family Motor proteins 0.00000241
Further Details:      
 
Domain Number 2 Region: 1376-1690
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.4e-54
Family WD40-repeat 0.0000802
Further Details:      
 
Domain Number 3 Region: 1016-1133
Classification Level Classification E-value
Superfamily Prefoldin 0.000000000016
Family Prefoldin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000003896   Gene: ENSAPLG00000004318   Transcript: ENSAPLT00000004503
Sequence length 1697
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742726.1:107093:126396:1 gene:ENSAPLG00000004318 transcript:ENSAPLT00000004503 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRPTRLPRRGDFCPPPALPEPHPAKPPLRALRAREELIGIDRCLPAARGLLSGRGHASSS
SCRIRPQLSKEKIEGCHICTSVTPGEPQVLLGKDKAFTYDFVFDLDTWQEQIYTTCVGKL
IEGCFEGYNATVLAYGQVPALPSFWXGTGFDMNISEDEQGIIPRAIGHLFSGIEERKRAA
QSQGVAAPEFKVSAQFLELYNEEILDLFDSARDPDARHRKSNIKIHEDASGSIYTTGVTS
RLISSQDELIQCLKQGALSRTTASTQMNVQSSRSHAIFTIHLCQMRVCARPELAEVNGEV
SGLLDGAQPPTEYETLTAKFHFVDLAGSERLKMGAAGGPGAPLGPAPGCSELLALGNVIS
ALGDQSKKVVHVPYRDSKLTRLLQDSLGGNSQTIMIACVSPSDRDFMETLNTLKYANRAR
NIKNKVVVNQDKTSQQISALRAEIARLQMELMEYKAGKRVIGEDGSEGYSDLFRENAMLQ
KENSALRMRVKAMQEAIDAINNRVTQLMSQEANLMLAKAGDGNEAIGALIQNYIREIEAP
RTKLLESESMNESLRRSLSRVSARPPYSVGSSPVPGLAAPAETEASDPAAPPLLSPSPEK
EAFKKRPKLQDNGEETDENEGEEVRGALRSCQGGXVVTEGCRSPPRRGTEPSLASQGGWG
GSEESLVDSDSDAEEKAVNFQADLADLTCEIEIKQKLIDELENSQRRLQTLKHQYEEKLI
LLQNKIRDTQLERDRVLQNLSTMECYTEEKANKIKADYEKRLKEMNRDLQKLQAAQKEHA
RLLKNQSRYERELRKLQAEVAEMKKAKVVALMKQMREEQQRRRLAETKRNREIAQLKKEQ
RRQEFQIRALESQKRQQEIVLRRKTQEVSALRRLAKPMSDRVAGRTSQKPPMLDSGAEVS
ASTTSSEPESGARSVSSIVRQWNRKINNFLGDPSPAANGARPPRSGRRGMSCVGRIREGW
WRSWAIQKRCSQSLGVLLGKTQLAKLPLFSPRNARSWRCCRRRCWARRASSSPKEQKGLQ
ELNEEIEVLGANIDYINDSISDCQATIMQIEETKEELDSTDTSVVISSCSLAEARLLLDN
FLKASIDKGLQVAQKEAQIRLLEGRLRQTDVTGSSQNHDALREKAESHPELQALIHNVQQ
ASPLCAENGYTSTDEEVSEFSLASDGSMKGSASQDDFKFKAKGGGKPAALCRLSDLYGKL
GICPSSCGRGARAAGPAAPLSPVSRPRESPSSPGRGGRGARHGAAPPDGEESRHPPCCSA
SPSPRQSRVSDTSPLTRRKSALGCRYEEEEFGRCRMSSPQITRPSNPSCLRPPDVGFTPX
NDRNVFSRLTSNQSQGSALDKSDDSDSSVSEVLSSRARGVINPVGGTKNARTAPLQCVSV
AEGHTKPVLCLDATDELLFTGSKDRSCKMWNLVTGQEIASLKGHPNNVVSIKYCSHTGLV
FTVSTSYIKVWDIRDSARCIRTLTSSGQVISGDACAGTTTRTVTSVQGEHQINQIALNPT
GTTLYAATGNSVRIWELSRLQPVGKLSGHIGPVMCLTVNQTASNHDLVVTGSKDHYVKVF
EIAEGMVGNIGPTHNFEPPHYDGIECLAIQGDVLFSGSRDNGIKKWDLEQQELSQQIPNA
HKDWVCALAFIPGRPMVLSACRGGVIKVWNVDNFTPVGEIKGHDSPINAICTNSKHIVTG
VCDLTVKLWSGRRLPAG
Download sequence
Identical sequences U3I9H5
ENSAPLP00000003896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]