SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000004831 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000004831
Domain Number 1 Region: 123-310
Classification Level Classification E-value
Superfamily Macro domain-like 7.74e-52
Family Macro domain 0.0000000138
Further Details:      
 
Domain Number 2 Region: 1-59
Classification Level Classification E-value
Superfamily Histone-fold 6.58e-18
Family Nucleosome core histones 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000004831   Gene: ENSAPLG00000005243   Transcript: ENSAPLT00000005452
Sequence length 311
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743017.1:1082495:1120168:1 gene:ENSAPLG00000005243 transcript:ENSAPLT00000005452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EILELAGNAARDNKKGRVTPRHILLAVANDEELNQLLKGVTIASGGVLPNIHPELLAKKR
GSKGKLEAIITPPPAKKAKSPSQKKTVSKKTGGKKGARKSKKKQGEVSKSASADSTTEGT
PADGFTVLSTKSLFLGQKLNLIHSEISNLAGFEVEAIINPTNADIDLKDDLGSTLEKKGG
KEFVEAVIELRKKNGPLDIAGAVVSAGHGLPAKFVIHCNSPGWGSDKCEELLEKTVKNCL
ALADEKKLKSIAFPSIGSGRNGFPKQTAAQLILKAISSYFVSTMSSSIKTVYFVLFDSES
IGIYVQEMAKL
Download sequence
Identical sequences U3IC59
ENSAPLP00000004831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]