SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000005047 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000005047
Domain Number 1 Region: 3-126
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.41e-19
Family WD40-repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000005047   Gene: ENSAPLG00000005500   Transcript: ENSAPLT00000005674
Sequence length 132
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743182.1:106377:106961:-1 gene:ENSAPLG00000005500 transcript:ENSAPLT00000005674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPPQLLASASYDDTVKLYREEEDDWVCCATLEGHESTVWXXXXXXXXXXXRLASCSDDKT
VRIWQQYKPGNEEGVACSGTDPTWKCVCNLSGYHTRTIYDVAWCHLTGALATACGDDAIR
VFEESSSSTPQQ
Download sequence
Identical sequences U3ICS5
ENSAPLP00000005047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]