SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000005748 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000005748
Domain Number 1 Region: 43-252
Classification Level Classification E-value
Superfamily Macro domain-like 1.79e-47
Family Macro domain 0.00025
Further Details:      
 
Domain Number 2 Region: 328-468
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000000000419
Family CRAL/TRIO domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000005748   Gene: ENSAPLG00000006123   Transcript: ENSAPLT00000006380
Sequence length 495
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743297.1:16675:34562:1 gene:ENSAPLG00000006123 transcript:ENSAPLT00000006380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPLGAPSKFVDIDTLPGWTDVYEAKQLDSHPNPVEKAQVDVRSPFPYRKDINEKIILWK
GDVALLNCTAIVNTSNESLTDKNPVSESVFMHAGPDLRDELQKLKGCRTGEAKLTKGFNL
AARFIIHTVGPKYKSRYRTAAESSLYSCYRNVLQLAKEQAMCSVGFCVINSLKRCYPLED
ATHIALRTVRRFLEIHGETLEKVVFAVSELEEATYQKLLPLYFPRSLEEEIQSLPYLPAD
IGNAEGEPVVPERQIRITEKPGVPDDASDEEGLEADLSFIGSHAFARMEGDVDKQRRLIL
QGQLSEAALQKQHQRNYNRWLCQARAEDLSDIASLKALYQTGVDNFGRTVMVVVGRNIPV
TLIDMEKALLYFIHVMDHIAVKEYVLVYFHTLTNDYNQLDSNFLKKLYDVVDAKYKRNLK
ALYFVHPTFRSKVSAWFFTTFTVSGLKDKIHYVESLQQLFTAIPPEQIDLPPFVLEYDAR
ENGPYYSSYPPSPDL
Download sequence
Identical sequences U3IES6
ENSAPLP00000005748 XP_005021895.1.99704 XP_005021896.1.99704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]