SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000005888 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000005888
Domain Number 1 Region: 143-220
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.62e-24
Family Intermediate filament protein, coiled coil region 0.00039
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000005888
Domain Number - Region: 53-144
Classification Level Classification E-value
Superfamily Prefoldin 0.000149
Family Prefoldin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000005888   Gene: ENSAPLG00000006301   Transcript: ENSAPLT00000006523
Sequence length 224
Comment pep:novel scaffold:BGI_duck_1.0:KB746064.1:267599:349828:-1 gene:ENSAPLG00000006301 transcript:ENSAPLT00000006523 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RYEEEINRRTAAENEFVVLKKDVDCAYMTKVELEAKVGALTDEINFLRCIYEEELAQLSA
QVSDTAVILSMDNNRDLDLSSIIAEVKSQYEDIANRSRAEAEAWYQTKYEELQATAGKHG
DDLRNTKGEISELNRLIQRIRAEIENTRNQCATLQTAIGDSEERGELALKDAKAKMTELE
DALQKAKADMARQLREYQELMNVKLALDIEIATYRKLLEGEESR
Download sequence
Identical sequences U3IF66
ENSAPLP00000005888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]