SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000006878 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000006878
Domain Number 1 Region: 5-57
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000171
Family Ankyrin repeat 0.0035
Further Details:      
 
Domain Number 2 Region: 68-110
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000183
Family SOCS box-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000006878   Gene: ENSAPLG00000007261   Transcript: ENSAPLT00000007529
Sequence length 111
Comment pep:novel scaffold:BGI_duck_1.0:KB742722.1:853927:855261:-1 gene:ENSAPLG00000007261 transcript:ENSAPLT00000007529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SFLVSGANVNAAKLHETALHHAAKVKNVDLVEMLIEFGGNIYARDNRGKKPSDYTWSSSP
TAKCFEYYEKTPLSLSQLCRVTVRKAAGQRALEKIAKLNIPQRLIQYLSYN
Download sequence
Identical sequences U3II06
ENSAPLP00000006878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]