SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000007097 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000007097
Domain Number 1 Region: 192-513
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.54e-116
Family Leucine aminopeptidase, C-terminal domain 0.000000000244
Further Details:      
 
Domain Number 2 Region: 34-189
Classification Level Classification E-value
Superfamily Macro domain-like 8.83e-46
Family Leucine aminopeptidase (Aminopeptidase A), N-terminal domain 0.000000434
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000007097   Gene: ENSAPLG00000007431   Transcript: ENSAPLT00000007751
Sequence length 519
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742628.1:648878:662307:-1 gene:ENSAPLG00000007431 transcript:ENSAPLT00000007751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PFLQHRPARRLLMRKVRGQRELWDRHLTAPLARGLVLGAYSSEQDGGAAQLTSAGDAFDR
LVSGKLRELLSVCGPPLKKGKTYLFHGLHQDFPSVAVVGLGKKNAGINDQENWNEDKENI
RAAVAVGCRQIQDLEIPCVEVDPCGDAQAAAEGAVLGLHEYNELKQKKKTAVTPQLHGSA
GSEAWQKGVIYAEGQNLARYLMEAPANYITPIKFAEYIEQKLRGFSSNVKVHIRPESWIA
TQQMGAFLSVAKGSAEPPIFLEIHYLGGANANDSPLVFVGKGVTFDSGGISLKPSSGMDA
MRADMGGAATVCSAIVTAATLNLPLNIIGLAPLCENMPSGKANKPGDVVRAKNGKTIQVD
NTDAEGRLLLADALCYAHNFNARAIVNAATLTGAMDVALGSAATGVFTNSSWLWNHLYEA
SILTGDRVWRMPLFEHYTKQVTDSPLADLSNIGKYSRAGGACTAAAFLKEFVTASHWAHL
DIAGVMSNKDEVPYLRKGMAGRPTRTLVEFAARLSQDSH
Download sequence
Identical sequences U3IIM5
ENSAPLP00000007097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]