SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000007526 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSAPLP00000007526
Domain Number - Region: 21-66
Classification Level Classification E-value
Superfamily Prefoldin 0.0139
Family Prefoldin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000007526   Gene: ENSAPLG00000007876   Transcript: ENSAPLT00000008189
Sequence length 421
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744072.1:669954:692210:1 gene:ENSAPLG00000007876 transcript:ENSAPLT00000008189 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKNIGEQLNKAYEAYRQACMDRDHAVKELQQKTENYMQQIREQQEQIELQNSIIAKLNS
QLAALNANRGNVHPYILMHEDIETSNLSCSQLSEKLNIAKRRERLLKVKSKKVAPDKPEL
SLGFSAISPGHARENLETIFQEMKEECHRICMLAREQTDQLSKFKIKPEPETEIQFSMPI
QCTDKTDEQAEELFKPRVIQDINRGASCITSITPRGVGQDEDNNSVESLSKFNVKFPPTD
NDSAFLQSTQEKPTVPCTGIAENMLQDHHFNLEHRDRAVNLSKLEPNSFEARGVDLMTSA
LQSLTTVDKTNPPNHANMPVENTRDKTCLKAADTGFTFIPKHTNQGSPEAIFPLEAAGTT
VRGPHQLIWQPQDNDLLAQAYTDSELNQCGVCEFCREVFPPSITSKEDFLRHLNSHFKVQ
S
Download sequence
Identical sequences U3IJV4
ENSAPLP00000007526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]