SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000008385 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000008385
Domain Number 1 Region: 237-314
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.79e-22
Family Intermediate filament protein, coiled coil region 0.0015
Further Details:      
 
Domain Number 2 Region: 8-42
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000575
Family Intermediate filament protein, coiled coil region 0.0029
Further Details:      
 
Domain Number 3 Region: 119-235
Classification Level Classification E-value
Superfamily Prefoldin 0.00000497
Family Prefoldin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000008385   Gene: ENSAPLG00000008723   Transcript: ENSAPLT00000009063
Sequence length 314
Comment pep:novel scaffold:BGI_duck_1.0:KB744753.1:30510:98751:1 gene:ENSAPLG00000008723 transcript:ENSAPLT00000009063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GDGILPAGEKETMQNLNDRLAAYLDKVRALEDANTDLEVKIREWYKKQGPGPDRDYSPYY
RTIEELRSKVLVATVDNANLLLQIDNARLTADDFRTKYETELALRQSVEADINGLRQVLD
QLTLCRSDLEAQLESLREELCCLKKNHEEEMNCLRKQSTGDVSVEVNACPGPDLRKILEE
MRCQYETLIERNRKEVEDWYECKIEEVNREVITSGQEVETCNNQVTELRRQLQALEIDLQ
AQLSQIDSLQSNLDDTERRYNMQLQQIQSMISPLEEELASIRCEMESQNQEYKMLLGIKT
RLEQEIAQYRSLLE
Download sequence
Identical sequences U3IMB3
ENSAPLP00000008385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]