SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000008503 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000008503
Domain Number 1 Region: 341-419
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 6.63e-25
Family Intermediate filament protein, coiled coil region 0.001
Further Details:      
 
Domain Number 2 Region: 112-146
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000105
Family Intermediate filament protein, coiled coil region 0.0029
Further Details:      
 
Domain Number 3 Region: 223-339
Classification Level Classification E-value
Superfamily Prefoldin 0.00000314
Family Prefoldin 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000008503   Gene: ENSAPLG00000008725   Transcript: ENSAPLT00000009183
Sequence length 471
Comment pep:novel scaffold:BGI_duck_1.0:KB744753.1:39359:44099:1 gene:ENSAPLG00000008725 transcript:ENSAPLT00000009183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTTTVRQYSSSSSLKGLGGLGGGCSRLSCVRGGGYRAPSVHGGSSSYSVSSRIVSGLGS
GYGGSYCSSVGGGLGAAFGGSYGAGFGSGFGAGFGSGFGGGFGGGDGILPAGEKETMQNL
NDRLAAYLDKVRALEDANTDLEVKIREWYKKQGPGPDRDYSPYYRTIEELRSKILAATVE
NANIVLQIDNARLAADDFRTKFETEQALRLSVEADINGLRRVLDELTLARADLEMQIESL
KEELAYLKKNHEEEMNALRGQVGGEISVEMDAAPGIDLTKILTDMREQYETLAEKNRRDA
EQWFFSKTEELNREVAINTEQLQSGKTEITELRRTIQSLEIDLQSQLSTKAALEGTLADT
ENRYGAQLAQLQGLITSVEEQLGELRCDMERQNHEYRVLLDVKCRLEQEIATYRRLLEGE
DAHISSQYSSAMSSHSGRDGMTSSRQVRTIVEEVQDGKVVSSREQVALTTR
Download sequence
Identical sequences U3IMN0
ENSAPLP00000008503 XP_005029396.1.99704 XP_012963817.1.99704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]