SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000008623 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000008623
Domain Number 1 Region: 252-329
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 3.31e-24
Family Intermediate filament protein, coiled coil region 0.0011
Further Details:      
 
Domain Number 2 Region: 22-56
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000105
Family Intermediate filament protein, coiled coil region 0.0019
Further Details:      
 
Domain Number 3 Region: 134-250
Classification Level Classification E-value
Superfamily Prefoldin 0.0000162
Family Prefoldin 0.017
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000008623
Domain Number - Region: 61-165
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0118
Family Myosin rod fragments 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000008623   Gene: ENSAPLG00000008949   Transcript: ENSAPLT00000009305
Sequence length 334
Comment pep:novel scaffold:BGI_duck_1.0:KB745531.1:184346:220678:-1 gene:ENSAPLG00000008949 transcript:ENSAPLT00000009305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGGFGSGFAGSFGMGGDALLSGNEKVTMQNLNDRLAAYLDKVRRLEEENAQLEHHIREWY
RKQAPTASKDYSAYYQTIEQLQNQILAATIDNSRVILEIDNARLAADDFRLKYENELFLR
QSVESDINGLRRVLDELTLARADLEMQIESLKEELAYLKKNHEEEMKEYSTQLSGTVNVE
MDAAPGIDLTRILTEMREQYEALAEKNRKDAEAWFLTQTDELNREVATHTEQIQTSKTEI
TELRRTLQSLEIELQSQMSMKAGLEANLRDTEGRYCAQLSQIQNLITSVEEQLGEIRCDM
ERQNQEYKMLMDIKSRLEQEIATYRQLLETQDSQ
Download sequence
Identical sequences U3IN00
ENSAPLP00000008623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]