SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000008717 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000008717
Domain Number 1 Region: 322-400
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 3.31e-25
Family Intermediate filament protein, coiled coil region 0.00087
Further Details:      
 
Domain Number 2 Region: 92-127
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000000942
Family Intermediate filament protein, coiled coil region 0.0022
Further Details:      
 
Domain Number 3 Region: 204-318
Classification Level Classification E-value
Superfamily Prefoldin 0.0000128
Family Prefoldin 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000008717   Gene: ENSAPLG00000008997   Transcript: ENSAPLT00000009402
Sequence length 413
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB745531.1:192946:198191:-1 gene:ENSAPLG00000008997 transcript:ENSAPLT00000009402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASYSFRQTTSSVAGGPGGCSVRFGGGSFRAPSIHGGSGGRGVSVSSARFVSSGLGSGLG
GGYGSGFSSSFGGGFGGGYGGGLGGGDGLLSGNEKTTMQNLNDRLASYLEKVRALEEANS
DLETKIRDWYQKQGPSPARDYSAYHKTIEDLRDQILAATIDNSKIVLQIDNARLAADDFK
TKFETEQALRMSVEADINGLRRVLDELTLARTDLELQIESLKEELAYLKKNHEEEMSALG
GQVAGQVSVELDSAPGIDLSKILADMRDQYELMAEKNRKDAEAWFHSKTEELNREVAVNT
EQLQSSKSEVSDLRRTLQGLEIELQSQLSMKGALESTLADTEGRYSAQLAHIQDLIGSIE
AQLADLRADMERQNSEYKMLMDIKSRLEQEIATYRQLLEGQESQMFGSLSGTA
Download sequence
Identical sequences U3IN94
ENSAPLP00000008717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]