SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000008987 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000008987
Domain Number 1 Region: 51-191
Classification Level Classification E-value
Superfamily C-type lectin-like 7.17e-35
Family C-type lectin domain 0.0000285
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000008987   Gene: ENSAPLG00000009299   Transcript: ENSAPLT00000009673
Sequence length 193
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742984.1:1680155:1685198:1 gene:ENSAPLG00000009299 transcript:ENSAPLT00000009673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQTGLRIFLLISILLLDQTISQASKFKARKHSKRRVKEKDDLKTQIDKLWREVNALKEM
QALQTVCLRGTKAHKKCYLISEGTKHFHEANEDCIAKGGTLAIPRNSDETNTLRDYGKKS
MPRVSEFWLGVNDMVNEGKFVDVNGMALQYFNWDRAQPNGGKRENCVFFSSQGKWVDEVC
RTAKRYICEFLIP
Download sequence
Identical sequences U3IP14
XP_005018315.1.99704 ENSAPLP00000008987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]