SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000009375 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000009375
Domain Number 1 Region: 337-636
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 9.26e-86
Family Pancreatic carboxypeptidases 0.000000000287
Further Details:      
 
Domain Number 2 Region: 763-1054
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 5.95e-63
Family Pancreatic carboxypeptidases 0.0000215
Further Details:      
 
Domain Number 3 Region: 7-217
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.64e-51
Family Pancreatic carboxypeptidases 0.000003
Further Details:      
 
Domain Number 4 Region: 636-712
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 7.26e-19
Family Carboxypeptidase regulatory domain 0.0000091
Further Details:      
 
Domain Number 5 Region: 218-296
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 3.34e-16
Family Carboxypeptidase regulatory domain 0.00047
Further Details:      
 
Domain Number 6 Region: 1055-1148
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000000000194
Family Carboxypeptidase regulatory domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000009375   Gene: ENSAPLG00000009596   Transcript: ENSAPLT00000010066
Sequence length 1221
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743446.1:749771:771881:-1 gene:ENSAPLG00000009596 transcript:ENSAPLT00000010066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGRGLGRLLNTTDLYLLPSLNPDGFERAREGDCGGGGGGEGGGRXXSRGRDLNRSFPDQF
GSAQPDLEPVPEVRALIAWMRRNKFLLSGNLHGGSVVASYPYDDSPTHRPTGVYSKSADD
EVFKYLAKAYASHHPIMRTGKPNCPGEEGETFQDGITNGAQWYDVEGGMQDYNYVWANCF
EITLELSCCKYPPTSELQQEWENNRESLLTFIEKVHIGVKGYVRDAITGAGLENATIVVA
GIAHNITAGKFGDYHRLLVPGTYNVTAVVMGYAPVTKENIEVKEGDATVVDFSLQPTVVA
PDPNLTQFTATPAPLSTLTPSVAQAEPPATTSLHRAVQPVDFRHHHFSDMEIFLRRYANE
YPSITRLYSVGKSVELRELYVMEISDNPGVHEAGEPEFKYIGNMHGNEVVGRELLLNLIE
YLCKNFGTDPEVTDLVQSTRIHIMPSMNPDGYEKSQEGDRGGTVGRNNSNNYDLNRNFPD
QFFQVTDPPQPETLAVMSWLKTYPFVLSANLHGGSLVVNYPFDDDEQGIAIYSKSPDDAV
FQQLALSYSKENKKMYQGSPCKDLYPTEYFPHGITNGAQWYNVPGGMQDWNYLNTNCFEV
TIELGCVKYPKAEELPKYWEQNRRSLLQFIKQVHRGIWGFVLDATDGRGILNATISVADI
NHPVTTYKDGDYWRLLVQGSYKVTASARGYDPVTKTVEVDSKGGVQVNFTLSRTDAKVEE
GKVPVLNTPDTSDPNEKEFETLIKDLSAENGLERLLLASSGKVSPYRYRPYKDLSEFLRG
LYLNYPHITNLTSLGQSVEFRQIWSLEISNKPNHSEPEEPKIRFVAGIHGNAPVGTELLL
ALAEFLCMNYKKNSAVTKLIDRTRIVIVPSLNPDGREIAQERGCTSKLGHANAHGRDLDT
DFTSNYSWYSGTREPETKAIIENLILKQDFSLSVALDGGSLLVTYPFDKPAQTVENKETL
KHLASVYANNHPLMHLGQPGCPNKSDENIPGGVIRGSEWHSHLGSMKDFSVTFGHCPEIT
VYTSCCYFPSAGQLPGLWADHRKSLLSMLVEVHKGVHGFVQDKSGKAISKATIVLNEGLR
VYTKEGGYFHVLLAPGLHNINAIADGYQQKHMKVLVRHDAPSSVFIVFDMENRIFGLPRE
LVVTVAGASMSALVLTACIIWCVCSIKSNRHKDGFHRLRQHHDDYEDEIRMMSTGSKKSL
LSHEFQDETDTEEETLYSSKH
Download sequence
Identical sequences U3IQ52
ENSAPLP00000009375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]