SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000009583 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000009583
Domain Number 1 Region: 33-246
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.35e-66
Family SPRY domain 0.0000000119
Further Details:      
 
Domain Number 2 Region: 235-272
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000889
Family SOCS box-like 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000009583   Gene: ENSAPLG00000009878   Transcript: ENSAPLT00000010279
Sequence length 273
Comment pep:novel scaffold:BGI_duck_1.0:KB742794.1:246777:252408:-1 gene:ENSAPLG00000009878 transcript:ENSAPLT00000010279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQKVTGGIKTVDMRDPVYRPLKQELQGLDYSKPTRLDLLLDMPPVSYEVQLLHSWNNDD
RSLNVFVKEDDKLIFHRHPVAQSTDAIRGKVGYTRGLHVWQITWAMRQRGTHAVVGVATA
DAPLHSVGYTTLVGNNHESWGWDLGRNRLYHDGKNQPSKTYPAFLEPDETFIVPDSFLVV
LDMDDGTLSFIVDGQYMGVAFRGLKGKKLYPVVSAVWGHCEIRMRYLNGLDPEPLPLMDL
CRRAVRLALGKERLNEIPALPLPASLKSYLLYQ
Download sequence
Identical sequences R0LRP1
ENSAPLP00000009583 XP_005015482.1.99704 XP_005015483.1.99704 XP_005015484.1.99704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]