SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000009760 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000009760
Domain Number 1 Region: 263-512
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.9e-64
Family Tandem AAA-ATPase domain 0.00011
Further Details:      
 
Domain Number 2 Region: 42-261
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.46e-56
Family Tandem AAA-ATPase domain 0.0000535
Further Details:      
 
Domain Number 3 Region: 720-877
Classification Level Classification E-value
Superfamily Macro domain-like 2.04e-29
Family Macro domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000009760   Gene: ENSAPLG00000009976   Transcript: ENSAPLT00000010457
Sequence length 900
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742906.1:1089568:1111676:1 gene:ENSAPLG00000009976 transcript:ENSAPLT00000010457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAPGPASPTAPSPSLALPTPPQRPAPQCPDGERDAGLGWGLTGIKLRPYQIEGVNWLVRC
YKVQHGCILGDEMGLGKTCQTISLLLYLMKKVTNKERFLILCPLSVLSNWKEELERFAPG
LSFVTYVGNKEERPKLQQNLKEQSHFHALLTTYEICLKDAAFLKLFNWAALVVDEAHRLK
NQSSLLYKTLSEFSVGFSVLLTGTPIQNSLQELYALLSFIEPDIFPREEVKAFVECYQAI
EKESETAKELHNLLQPFLLRRVKSEVAAELPKKVEVVLYHGMSALQRKYYKAILMKDLDA
FESETGKRVTLQNVLSQLRKCVAHPYLFNGVEPEPFEIGDHIVEASGKLCLLDKLLSFLY
AGGHRVLLFSQMTQLLDILQDYMDYRGYSYERLDGSVRGEERHLAIKNFGQQPIFVFLLS
TRAGGVGMNLTAADTVIFADSDFNPQNDLQAIARAHRIGQHKPVKIIRLIGRDTIEEIIY
RRAASKLRLTNAIVEGGQFALGVPKPQGAADLQLSEILKFGLDKLLSSEGSTIQDVELEN
ILGETKEGKWITDVVLPREDENEEEDTESKDHMYVYEGKDYSKEPSREDKKAFDQLLDLQ
KALTEETTMEGRALRNKTNALLSGLREQSTRRKHLLSTEELEARRKKRQEAAAKRARLME
ERRKAKAEAEHMKKMAWWESNHYTSSCLPSEESDSEEESEEGESGLNVDLDYRDVDLNCI
KYVMGDVTHPKAEEEDAIIVHCLDDSGRWGRGGLFTALETRSDQPRKVYEMAGKMKDLHL
GGTLLFPIDDKKSRKKGQDLLALIVAQHRDRSNNLSGIKLSALEKGLKKIYFAAKKRNAS
VHLPRIGYATRGFNWYGTERLIRKYLAARGIPTLIYYFPRNKGFSSASQPSSSSTTVSKP
Download sequence
Identical sequences U3IR87
ENSAPLP00000009760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]