SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000009812 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000009812
Domain Number 1 Region: 175-501
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 7.28e-80
Family Pancreatic carboxypeptidases 0.00000164
Further Details:      
 
Domain Number 2 Region: 37-159
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 2.75e-32
Family Frizzled cysteine-rich domain 0.00042
Further Details:      
 
Domain Number 3 Region: 501-579
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 1.47e-18
Family Carboxypeptidase regulatory domain 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000009812   Gene: ENSAPLG00000010071   Transcript: ENSAPLT00000010511
Sequence length 648
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742833.1:4469776:4501685:-1 gene:ENSAPLG00000010071 transcript:ENSAPLT00000010511 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLRLLLFLTGLLRATEPAPRCETGQETLATLQCNEAKCVDISLSSCTDVAYTQTMYPNF
LDQKSREVIEYSSEYILISVLHNLLQGECNPDLRLLGCSVLAPQCEKDKVIKPCRHVCEN
LKKNCLPAFDAIDMAWPYFLDCDRFFAGEEEGCFDPLAKLRGEVEIEEDLPSDLPATFIQ
FKHHSYAQMVSTLKKTASRCSHIATTYSIGRSFEGKDLFVIEFSTKPGHHELLKPEFKYI
GNMHGNEVVGKELLIYLAQYLCSEYLLGNPRIQTLINNTRIHLLPSLNPDGYELAAEEGA
GYNGWVIGRQTAQNLDLNRNFPDLTSEAYRRAGIRGARLDHIPIPQSYWWGKVAPETKAV
MKWLRSIPFVLSASLHGGELVVTYPYDYSRHPLEEKEFSPTPDEKMFKMLAKAYADAHPV
ISDRSELRCGGNFVKRGGIINGAEWYSFTGGMADFNYLHTNCFEVTVEVGCEKFPLEEEL
FTIWHENRDALLNYMEMVHRGIKGIVSDKFGNPIKNARISVRGIQHDVTTAADGDYWRLL
PPGTYIISAQAAGYSKVMKRVTLPTKMKRAGRVDFVLRPVEVWPNKLLRRPMEDMHDQYD
PLELFDPHAQHAQPGTRGGSPQPREKPWWWSYFSSLDLHKPLWLLKQH
Download sequence
Identical sequences U3IRD9
ENSAPLP00000009812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]