SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000010021 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000010021
Domain Number 1 Region: 16-236
Classification Level Classification E-value
Superfamily Macro domain-like 1.63e-53
Family Macro domain 0.0001
Further Details:      
 
Domain Number 2 Region: 249-417
Classification Level Classification E-value
Superfamily Macro domain-like 1.31e-29
Family Macro domain 0.001
Further Details:      
 
Domain Number 3 Region: 581-752
Classification Level Classification E-value
Superfamily ADP-ribosylation 3.07e-20
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000010021   Gene: ENSAPLG00000010291   Transcript: ENSAPLT00000010725
Sequence length 753
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB743181.1:134479:143283:-1 gene:ENSAPLG00000010291 transcript:ENSAPLT00000010725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLMIPINKDAYEVLKKREQCLSNLIDKKFACAFTFGSVKSTAEVYRTILKQGIQILVCKD
DLTKHKADALVNAANEYLAHDGGLALALASAGGPEIKEESSIYINKYGKLATGNIAVTGG
GKLPCKKIIHAVGPRWYMLEKTECCVLLEEAIVNVLKYANAPENGIKSVAIPAVSSGIFG
FPLNLCAQVIVMAIKGFFERSPPGSLKEVRLVNICDKTVAEMKKACEKFLGDSNSLQETA
PASPSDPVSVIVGNWRLRILKGHIEEQETGAIVSSVSSDGMLYSPFSSPMMQKAGPALQE
EILSQLRHSTSYKKLIITKGYNLPCKHVLHVVWQQYKHQLKEAVTKCLCSIQNLKSRSVS
FPAKGIWSAVLSEETVAEIMIEEVSNFARKFPDMLDVQFVLCPDDSASYQAFQRKLNSVA
RKKQEKQYNYGSSHPSSESDSQSMTKTPNNKLAIELKGSTHIALKAAESWVQRIIKAQES
PSACIENNFIFSLGKEEFAELSREQHSGVRVLEKVRGGKASLEFHGPPDAVIDAVLTAEK
LLLRVQDKTTAKQEELLQLIEGPLHKTNDAKRFQISQVESHLQEFRDRQKQFEKAGLHVH
KIEKIRNPLLSAAFQQMKKNIEEKGGSSNVSHKLYQRVPAEFCTSVCQTGFHRMYSPPTD
QRYGAGIYFKRNPKSLIEDGGDWENDSKMYVFEADVLTGLYTGGRQSYIIPPAVEGDATK
MYDSLVDDESNPGIFVICNSVQALPHYLLTCSQ
Download sequence
Identical sequences U3IRZ8
ENSAPLP00000010021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]