SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000010582 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000010582
Domain Number 1 Region: 82-247
Classification Level Classification E-value
Superfamily RUN domain-like 2.62e-52
Family RUN domain 0.000000181
Further Details:      
 
Domain Number 2 Region: 609-676
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 7.67e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.001
Further Details:      
 
Domain Number 3 Region: 288-334
Classification Level Classification E-value
Superfamily Prefoldin 0.000034
Family Prefoldin 0.011
Further Details:      
 
Weak hits

Sequence:  ENSAPLP00000010582
Domain Number - Region: 401-498
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0314
Family Myosin rod fragments 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000010582   Gene: ENSAPLG00000010790   Transcript: ENSAPLT00000011299
Sequence length 679
Comment pep:novel scaffold:BGI_duck_1.0:KB743585.1:248559:263351:-1 gene:ENSAPLG00000010790 transcript:ENSAPLT00000011299 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDFEIIDKNQIPSATELKNEEKEKAAEEARWSAPILSLAKKASENLALSYGNALKSAALV
GFISKPVSNDNTAKTSVRYHAMEERANLMNMMKLSIKTLIQSALSLGRTLDSDFPPLQQF
FVVLEHCLKHGLKVKKTFIGQNKSFFGPLELVEKLCPEASDIATSVKNLPELKTAVGRGR
AWLYLALMQKKLADYLKVLLDHKHLLSEFYEPDALMMEEEGAVIVGLLVGLNVIDANLCL
KGEDLDSQVGVIDFSLYLKETQDSDSKQDGGITAVLDQKHYVEELNRHLSCTVADLQNKI
DCLEKTNSKLQEELAAATDRIGSLQEEQQQLKQQNELIRERSEKSVEVTKEDTKVELDTY
RQSRQGLDEMYSDVWKQLKEEKKIRLELEKELELQIGMKTEMEIAMKLLEKDTHEKQDTL
VALRQQLEEVKAINLQMFHKSQNAESSLQQKTEAISSFEEKTNEMMSSMKQMEERLQHAE
KARQAAEERCNKMKQELAGRLDTCRQQMSQLDSKCSTLEKELKSEKEQRQTLQRELHQEK
DATSLLKTELEQMEGLKKELRKLQDEKQQLEKVCEEQEQALQEMGLHLSQSKLKMEDIKE
VNKALKGHTWLKDDEATHCKQCEKEFSISRRKHHCRNCGDIFCNTCSSNELALPSYPKPV
RVCDTCHTLLLQRCSSNSS
Download sequence
Identical sequences R0KXA1
ENSAPLP00000010582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]