SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000010854 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000010854
Domain Number 1 Region: 4-264
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.75e-70
Family Pancreatic carboxypeptidases 0.0000000211
Further Details:      
 
Domain Number 2 Region: 265-344
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 3.14e-21
Family Carboxypeptidase regulatory domain 0.0000715
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000010854   Gene: ENSAPLG00000011100   Transcript: ENSAPLT00000011572
Sequence length 346
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB744042.1:74078:85875:1 gene:ENSAPLG00000011100 transcript:ENSAPLT00000011572 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPLKGRDLWVLVLGRFPTQHKIGIPEFKYVANMHGDETVGREILLHLIDYLVTSYGRDPN
ITKLLNNTRIHIMPTMNPDGFEATKVPHCYYSRGRYNKNGEDLNRNFPDAFENNNVTIQP
ETRAVMNWIKNETFVLSANLHGGALVASYTFDNGNSVTGSSKGYSRSPDDDVFIHLAKTY
SFNHASMYKGTGCDSRQTFPDGITNGYSWYQLEGGMQDYNYVWGQCFEITLELSCCKYPP
ADQLEKFWTDNKVALVEYIKQVHLGVKGQVTDRNGNPIPNAIVEAQGRSHVCPYRTNAHG
EYFLLLLPGKYVINATVPGFKSMLKTVEIPDNTANFNALKQDFSFS
Download sequence
Identical sequences U3IUD1
ENSAPLP00000010854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]