SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000010919 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000010919
Domain Number 1 Region: 3-263
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 7.94e-61
Family Pancreatic carboxypeptidases 0.00000142
Further Details:      
 
Domain Number 2 Region: 284-343
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000000275
Family Carboxypeptidase regulatory domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000010919   Gene: ENSAPLG00000011182   Transcript: ENSAPLT00000011638
Sequence length 381
Comment pep:known_by_projection scaffold:BGI_duck_1.0:KB742660.1:259634:267306:-1 gene:ENSAPLG00000011182 transcript:ENSAPLT00000011638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VEPEFKYVGNNMHGNEVLGRELLLQLSEFLCEEYRRGSERVTRLLHNTRIHIMPSMNPDG
YEVAAKQGPDSIGYLTGRNNANGVDLNRNFPDLNTFMYYSGEISGPNHHIPLPDNWKSQV
EPETLAVIQWIGSYNFVLSANLHGGAVVANYPYDKSRFRSHRRTVNTPTPDDKLFQKLAK
TYSYAHGWMHRGWNCGDYFADGITNGASWYSLSKGMQDFNYLYTNCFEITLELSCNKFPP
EKDLERQWMANREALVAFIEEILQFSRGQTRESSKLTSGHRSVTRWHSNTCVPGDMGDYF
RLLLPGTYTVTASAEGYQPQTVTTTVGPAEPSLVHFQLKQDVVRKPPERKASGTRTNNKT
LQKARESWRSSSGCEHHASPS
Download sequence
Identical sequences U3IUJ6
ENSAPLP00000010919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]