SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAPLP00000011321 from Anas platyrhynchos 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAPLP00000011321
Domain Number 1 Region: 36-89
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000286
Family HkH motif-containing C2H2 finger 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAPLP00000011321   Gene: ENSAPLG00000011579   Transcript: ENSAPLT00000012045
Sequence length 113
Comment pep:novel scaffold:BGI_duck_1.0:KB744012.1:347599:348068:-1 gene:ENSAPLG00000011579 transcript:ENSAPLT00000012045 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SFYPENMKKPWSPDLPADNHLYNSDFTSIPGRESEKELAPDGTEEKKEREKKQTNFTLCN
VCNIQLNSAAQAQIHYNGKSHQKRLKQLSNGNLKSDNEYQIISMISLFFSFIY
Download sequence
Identical sequences U3IVP7
ENSAPLP00000011321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]